PDB entry 2rus

View 2rus on RCSB PDB site
Description: crystal structure of the ternary complex of ribulose-1,5-bisphosphate carboxylase, mg(II), and activator co2 at 2.3-angstroms resolution
Class: lyase(carbon-carbon)
Keywords: lyase(carbon-carbon)
Deposited on 1991-10-11, released 1991-10-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubisco (ribulose-1,5-bisphosphate carboxylase(slash)oxygenase)
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04718
      • conflict (114)
    Domains in SCOPe 2.05: d2rusa1, d2rusa2
  • Chain 'B':
    Compound: rubisco (ribulose-1,5-bisphosphate carboxylase(slash)oxygenase)
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04718
      • conflict (114)
    Domains in SCOPe 2.05: d2rusb1, d2rusb2
  • Heterogens: MG, FOR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rusA (A:)
    tmitnspdrwgysaphrtsresppmdqssryvnlalkeedliaggehvlcayimkpkagy
    gyvataahfaaesstgtnvevcttddftrgvdalvyevdeareltkiaypvalfdrnitd
    gkamiasfltltmgnnqgmgdveyakmhdfyvpeayralfdgpsvnisalwkvlgrpevd
    gglvvgtiikpklglrpkpfaeachafwlggdfikndepqgnqpfaplrdtialvadamr
    raqdetgeaklfsanitaddpfeiiargeyvletfgenashvallvdgyvagaaaittar
    rrfpdnflhyhraghgavtspqskrgytafvhckmarlqgasgihtgtmgfgkmegessd
    raiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffenlgnanviltaggga
    fghidgpvagarslrqawqawrdgvpvldyarehkelarafesfpgdadqiypgwrkalg
    vedtrsalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rusA (A:)
    dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtntrgvdal
    vyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpe
    ayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfi
    kndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvlet
    fgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhck
    marlqgasgihtgtsdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgff
    enlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelarafesf
    pgdadqiypgwrkalgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rusB (B:)
    tmitnspdrwgysaphrtsresppmdqssryvnlalkeedliaggehvlcayimkpkagy
    gyvataahfaaesstgtnvevcttddftrgvdalvyevdeareltkiaypvalfdrnitd
    gkamiasfltltmgnnqgmgdveyakmhdfyvpeayralfdgpsvnisalwkvlgrpevd
    gglvvgtiikpklglrpkpfaeachafwlggdfikndepqgnqpfaplrdtialvadamr
    raqdetgeaklfsanitaddpfeiiargeyvletfgenashvallvdgyvagaaaittar
    rrfpdnflhyhraghgavtspqskrgytafvhckmarlqgasgihtgtmgfgkmegessd
    raiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffenlgnanviltaggga
    fghidgpvagarslrqawqawrdgvpvldyarehkelarafesfpgdadqiypgwrkalg
    vedtrsalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rusB (B:)
    qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtntrgvdalv
    yevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpea
    yralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfik
    ndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletf
    genashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckm
    arlqgasgihtgtmgfgkgessdraiaymltqdeaqgpfyrqswggmkactpiisggmna
    lrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkel
    arafesfpgdadqiypgwrkalgv