PDB entry 2rus

View 2rus on RCSB PDB site
Description: crystal structure of the ternary complex of ribulose-1,5-bisphosphate carboxylase, mg(ii), and activator co2 at 2.3-angstroms resolution
Deposited on 1991-10-11, released 1991-10-15
The last revision prior to the SCOP 1.59 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rusA (A:)
    dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
    dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
    kmhdfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeach
    afwlggdfikndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeii
    argeyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskr
    gytafvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmk
    actpiisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgv
    pvldyarehkelarafesfpgdadqiypgwrkalgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rusA (A:)
    dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtntrgvdal
    vyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpe
    ayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfi
    kndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvlet
    fgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhck
    marlqgasgihtgtsdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgff
    enlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelarafesf
    pgdadqiypgwrkalgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rusB (B:)
    qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttdd
    ftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyak
    mhdfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeacha
    fwlggdfikndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiia
    rgeyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrg
    ytafvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmka
    ctpiisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgvp
    vldyarehkelarafesfpgdadqiypgwrkalgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rusB (B:)
    qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtntrgvdalv
    yevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpea
    yralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfik
    ndepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletf
    genashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckm
    arlqgasgihtgtmgfgkgessdraiaymltqdeaqgpfyrqswggmkactpiisggmna
    lrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkel
    arafesfpgdadqiypgwrkalgv