PDB entry 2ru6

View 2ru6 on RCSB PDB site
Description: The pure alternative state of ubiquitin
Class: protein binding
Keywords: ubiquitin, alternatively folded state, high-pressure NMR, Q41N variant, PROTEIN BINDING
Deposited on 2013-12-04, released 2014-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin
  Species: Homo sapiens [TaxId:9606]
  Gene: UBC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CG48 (0-75)
    • engineered mutation (40)
  Domains in SCOPe 2.07: d2ru6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ru6A (A:)
  mqifvktltgktitlevepsdtienvkakiqdkegippdqnrlifagkqledgrtlsdyn
  iqkestlhlvlrlrgg