PDB entry 2rtm

View 2rtm on RCSB PDB site
Description: streptavidin-2-iminobiotin-sulfate complex, ph 3.50, space group i4122
Deposited on 1997-09-11, released 1998-10-14
The last revision prior to the SCOP 1.59 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.199
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d2rtm__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rtm_ (-)
  aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
  lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
  vkp