PDB entry 2rr8

View 2rr8 on RCSB PDB site
Description: Solution structure of calponin homology domain of IQGAP1
Class: protein binding
Keywords: F-actin binding protein, PROTEIN BINDING
Deposited on 2010-06-09, released 2010-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IQGAP1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IQGAP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P1N4 (5-189)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d2rr8a1, d2rr8a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rr8A (A:)
gplgsltaeemderrrqnvayeylchleeakrwmeaclgedlpptteleeglrngvylak
lgnffspkvvslkkiydreqtrykatglhfrhtdnviqwlnamdeiglpkifypettdiy
drknmprciycihalslylfklglapqiqdlygkvdfteeeinnmktelekygiqmpafs
kiggilanel