PDB entry 2roa

View 2roa on RCSB PDB site
Description: Solution structure of calcium bound soybean calmodulin isoform 4 N-terminal domain
Class: metal binding protein
Keywords: soybean calmodulin, plant calmodulin, calmodulin isoform, target binding, target activation, Calcium, METAL BINDING PROTEIN
Deposited on 2008-03-14, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2roaa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2roaA (A:)
    adilseeqivdfkeafglfdkdgdgcitveelatvirsldqnpteeelqdmisevdadgn
    gtiefdeflslmakkvkdt