PDB entry 2rnx

View 2rnx on RCSB PDB site
Description: The Structural Basis for Site-Specific Lysine-Acetylated Histone Recognition by the Bromodomains of the HUman Transcriptional Co-Activators PCAF and CBP
Class: transferase/nuclear protein
Keywords: Bromodomain, Histone, Acetyltransferase, NMR, Acyltransferase, Cell cycle, Host-virus interaction, Nucleus, Polymorphism, Transcription, Transcription regulation, Acetylation, Chromosomal protein, DNA damage, DNA repair, DNA-binding, Methylation, Nucleosome core, Phosphoprotein, TRANSFERASE/NUCLEAR PROTEIN COMPLEX
Deposited on 2008-02-03, released 2008-05-06
The last revision prior to the SCOP 1.75 freeze date was dated 2008-05-06, with a file datestamp of 2008-05-02.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase PCAF
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92831 (4-117)
      • expression tag (0-3)
    Domains in SCOP 1.75: d2rnxa1
  • Chain 'B':
    Compound: histone h3
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61830 (0-11)
      • insertion (12)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rnxA (A:)
    gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
    erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk
    

  • Chain 'B':
    No sequence available.