PDB entry 2rne

View 2rne on RCSB PDB site
Description: Solution structure of the second RNA recognition motif (RRM) of TIA-1
Class: RNA binding protein
Keywords: RRM domain, RNA BINDING PROTEIN
Deposited on 2007-12-19, released 2008-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tia1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: Tia1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80ZW7 (7-108)
      • expression tag (0-6)
      • expression tag (109-114)
    Domains in SCOPe 2.07: d2rnea1, d2rnea2, d2rnea3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rneA (A:)
    gssgssgqkkdtsnhfhvfvgdlspeittedikaafapfgrisdarvvkdmatgkskgyg
    fvsffnkwdaenaiqqmggqwlggrqirtnwatrkppapkstyesntkqsgpssg