PDB entry 2rmm

View 2rmm on RCSB PDB site
Description: Solution structure of GB1 A34F mutant
Class: immune system
Keywords: GB1 mutant, Cell wall, IgG-binding protein, Peptidoglycan-anchor, Secreted, IMMUNE SYSTEM
Deposited on 2007-10-30, released 2007-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (2-55)
      • expression tag (0-1)
      • engineered (33)
    Domains in SCOPe 2.07: d2rmma1, d2rmma2
  • Chain 'B':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (2-55)
      • expression tag (0-1)
      • engineered (33)
    Domains in SCOPe 2.07: d2rmmb1, d2rmmb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmmA (A:)
    mqyklilngktlkgettteavdaataekvfkqyfndngvdgewtyddatktftvte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmmB (B:)
    mqyklilngktlkgettteavdaataekvfkqyfndngvdgewtyddatktftvte