PDB entry 2rmk

View 2rmk on RCSB PDB site
Description: Rac1/PRK1 Complex
Class: membrane protein/transferase
Keywords: G protein, effector, ADP-ribosylation, Alternative splicing, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Polymorphism, Prenylation, ATP-binding, Cytoplasm, Kinase, Phosphorylation, Serine/threonine-protein kinase, Transferase, MEMBRANE PROTEIN/TRANSFERASE COMPLEX
Deposited on 2007-10-25, released 2007-11-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (0-191)
      • engineered (60)
    Domains in SCOPe 2.03: d2rmka1
  • Chain 'B':
    Compound: Serine/threonine-protein kinase N1
    Species: Homo sapiens [TaxId:9606]
    Gene: PKN1, PKN, PRK1, PRKCL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16512 (3-80)
      • expression tag (0-2)
    Domains in SCOPe 2.03: d2rmkb1
  • Heterogens: MG, GCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmkA (A:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    ledydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    pvkkrkrkclll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmkB (B:)
    gipatnlsrvaglekqlaielkvkqgaenmiqtysngstkdrkllltaqqmlqdsktkid
    iirmqlrralqadqlenqaap