PDB entry 2rma

View 2rma on RCSB PDB site
Description: Crystal structures of cyclophilin A complexed with cyclosporin A and N-methyl-4-[(E)-2-butenyl]-4,4-dimethylthreonine cyclosporin A
Class: isomerase/immunosuppressant
Keywords: isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, cyclosporin a, immunosuppressant, cyclophilin
Deposited on 1994-01-07, released 1995-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmaa_
  • Chain 'B':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'C':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmac_
  • Chain 'D':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'E':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmae_
  • Chain 'F':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'G':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmag_
  • Chain 'H':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'I':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmai_
  • Chain 'J':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'K':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmak_
  • Chain 'L':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'M':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmam_
  • Chain 'N':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'O':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmao_
  • Chain 'P':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'Q':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmaq_
  • Chain 'R':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'S':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmas_
  • Chain 'T':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmaA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmaC (C:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmaE (E:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmaG (G:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmaI (I:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmaK (K:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmaM (M:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmaO (O:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmaQ (Q:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmaS (S:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'T':
    No sequence available.