PDB entry 2rkp

View 2rkp on RCSB PDB site
Description: Crystal structure of the catalytic subunit of human protein kinase CK2 with 5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole
Class: Transferase
Keywords: Protein kinase CK2, human CK2alpha, DRB, Eukaryotic protein kinase fold, protein kinase inhibitor complex, allosteric binding site, ATP-binding, Nucleotide-binding, Serine/threonine-protein kinase, Transferase, Wnt signaling pathway
Deposited on 2007-10-17, released 2007-11-06
The last revision prior to the SCOP 1.75 freeze date was dated 2008-03-04, with a file datestamp of 2008-02-29.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.146
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: HOMO SAPIENS
    Gene: CSNK2A1 OR CK2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2rkpa1
  • Heterogens: CL, RFZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rkpA (A:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqarmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rkpA (A:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvkdqarmg