PDB entry 2rkf

View 2rkf on RCSB PDB site
Description: HIV-1 PR resistant mutant + LPV
Class: hydrolase
Keywords: resistence, insertion, HYDROLASE
Deposited on 2007-10-16, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0F7J4 (0-98)
      • engineered (12)
      • engineered (15)
      • engineered (19)
      • engineered (36)
      • engineered (45)
      • engineered (53)
      • engineered (62)
      • engineered (92)
    Domains in SCOPe 2.07: d2rkfa_
  • Chain 'B':
    Compound: protease retropepsin
    Species: human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0F7J4 (0-98)
      • engineered (12)
      • engineered (15)
      • engineered (19)
      • engineered (36)
      • engineered (45)
      • engineered (53)
      • engineered (62)
      • engineered (92)
    Domains in SCOPe 2.07: d2rkfb_
  • Heterogens: SO4, AB1, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rkfA (A:)
    pqitlwqrpfvtvkiagqlmealldtgaddtileemslpgrwtpkvvggiggfmkvrqyd
    qilveicghkvigtvlvgptpaniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rkfB (B:)
    pqitlwqrpfvtvkiagqlmealldtgaddtileemslpgrwtpkvvggiggfmkvrqyd
    qilveicghkvigtvlvgptpaniigrnlltqigctlnf