PDB entry 2rk9

View 2rk9 on RCSB PDB site
Description: The crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase superfamily member from Vibrio splendidus 12B01
Class: oxidoreductase
Keywords: 11005r, Glyoxalase/bleomycin resistance protein/dioxygenase superfamily, NYSGXRC, Structural Genomics, Protein Structure Initiative II, New York SGX Research Center for Structural Genomics, PSI-2, OXIDOREDUCTASE
Deposited on 2007-10-16, released 2007-10-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.209
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glyoxalase/bleomycin resistance protein/dioxygenase
    Species: Vibrio splendidus [TaxId:314291]
    Gene: 84385607, V12B01_25774
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3UM69 (3-End)
      • engineered (120)
  • Chain 'B':
    Compound: Glyoxalase/bleomycin resistance protein/dioxygenase
    Species: Vibrio splendidus [TaxId:314291]
    Gene: 84385607, V12B01_25774
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3UM69 (3-End)
      • engineered (120)
    Domains in SCOPe 2.02: d2rk9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rk9B (B:)
    msltlrvvpelycfdinvsqsffvdvlgfevkyerpdeefvyltldgvdvmlegiagksr
    kwlsgdlefplgsgvnfqwdvidieplyqrvnesaadsiylalesksyqcgdsiatqkqf
    mvqtpdgylfrfcqdiheghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rk9B (B:)
    tlrvvpelycfdinvsqsffvdvlgfevkyerpdeefvyltldgvdvmleglefplgsgv
    nfqwdvidieplyqrvnesaadsiylalesksyqiatqkqfmvqtpdgylfrfcqdi