PDB entry 2rk5

View 2rk5 on RCSB PDB site
Description: Crystal structure of a domain of the putative hemolysin from Streptococcus mutans UA159
Class: toxin
Keywords: Hemolysin, Structural genomics, PSI-2, MCSG, Protein Structure Initiative, Midwest Center for Structural Genomics, Membrane, Transmembrane, TOXIN
Deposited on 2007-10-16, released 2007-11-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.182
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative hemolysin
    Species: Streptococcus mutans UA159 [TaxId:210007]
    Gene: hlyX, SMU_1693
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68574 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.01: d2rk5a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rk5A (A:)
    qsreiadntyivlgtmtlndfneyfetdlesdnvdtiagfyltgvgtipsqeekehfeve
    sngkhlelindkvkdgrvtklkilvse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rk5A (A:)
    qsreiadntyivlgtmtlndfneyfetdlesdnvdtiagfyltgvgtipsqeekehfeve
    sngkhlelindkvkdgrvtklkilvs