PDB entry 2rjn

View 2rjn on RCSB PDB site
Description: Crystal structure of an uncharacterized protein Q2BKU2 from Neptuniibacter caesariensis
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, Oceanospirillum sp. MED92, Neptuniibacter caesariensis, PSI-2, PROTEIN STRUCTURE INITIATIVE, New York SGX Research Center for Structural Genomics, NYSGXRC, Hydrolase
Deposited on 2007-10-15, released 2007-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver:Metal-dependent phosphohydrolase, HD subdomain
    Species: Neptuniibacter caesariensis [TaxId:207954]
    Gene: MED92_01309
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rjna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rjnA (A:)
    mslnyknytvmlvddeqpilnslkrlikrlgcniitftspldalealkgtsvqlvisdmr
    mpemggevfleqvaksypdiervvisgyadaqatidavnrgkisrfllkpwededvfkvv
    ekglqlaflreenlrlqeeteaknkqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rjnA (A:)
    nyknytvmlvddeqpilnslkrlikrlgcniitftspldalealkgtsvqlvisdmrmpe
    mggevfleqvaksypdiervvisgyadaqatidavnrgkisrfllkpwededvfkvvekg
    lqlaflreenlrlqe