PDB entry 2rjk

View 2rjk on RCSB PDB site
Description: Crystal Structure of Human TL1A Extracellular Domain C95S Mutant
Class: cytokine
Keywords: TL1A, TNFSF, CYTOKINE, MUTANT, Membrane, Transmembrane
Deposited on 2007-10-15, released 2008-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TNF superfamily ligand TL1A
    Species: HOMO SAPIENS
    Gene: TNFSF15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rjka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rjkA (A:)
    gshmlkgqefapshqqvyaplradgdkprahltvvrqtptqhfknqfpalhwehelglaf
    tknrmnytnkfllipesgdyfiysqvtfrgmtsesseirqagrpnkpdsitvvitkvtds
    ypeptqllmgtksvcevgsnwfqpiylgamfslqegdklmvnvsdislvdytkedktffg
    afll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rjkA (A:)
    gdkprahltvvrqtptqfpalhwehelglaftknrmnytnkfllipesgdyfiysqvtfr
    gmkpdsitvvitkvtdsypeptqllmgtksvcevgsnwfqpiylgamfslqegdklmvnv
    sdislvdytkedktffgafll