PDB entry 2rid

View 2rid on RCSB PDB site
Description: Crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein D in complex with Allyl 7-O-carbamoyl-L-glycero-D-manno-heptopyranoside
Class: sugar binding protein
Keywords: surfactant protein; carbohydrate recognition; domain trimeric, sugar binding protein
Deposited on 2007-10-10, released 2008-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD, PSPD, SFTP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rida1, d2rida2
  • Chain 'B':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD, PSPD, SFTP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ridb1, d2ridb2
  • Chain 'C':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD, PSPD, SFTP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ridc1, d2ridc2
  • Heterogens: CA, 291, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ridA (A:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ridA (A:)
    qqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqaggql
    asprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnddggs
    edcveiftngkwndracgekrlvvcef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ridB (B:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ridB (B:)
    aslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqa
    ggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnd
    dggsedcveiftngkwndracgekrlvvcef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ridC (C:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ridC (C:)
    lrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqagg
    qlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnddg
    gsedcveiftngkwndracgekrlvvcef