PDB entry 2rhe

View 2rhe on RCSB PDB site
Description: structure of a novel bence-jones protein (rhe) fragment at 1.6 angstroms resolution
Deposited on 1983-06-13, released 1983-09-15
The last revision prior to the SCOP 1.63 freeze date was dated 1988-10-09, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.149
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d2rhe__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rhe_ (-)
    esvltqppsasgtpgqrvtisctgsatdigsnsviwyqqvpgkapklliyyndllpsgvs
    drfsasksgtsaslaisglesedeadyycaawndsldepgfgggtkltvlgqpk