PDB entry 2rhd

View 2rhd on RCSB PDB site
Description: Crystal structure of Cryptosporidium parvum small GTPase RAB1A
Class: nucleotide binding protein
Keywords: GTPase, RAB1A, Cryptosporidium parvum, SGC, in situ, proteolysis, GTP-binding, Nucleotide-binding, NUCLEOTIDE BINDING PROTEIN, Structural Genomics, Structural Genomics Consortium
Deposited on 2007-10-09, released 2007-10-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.181
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small GTP binding protein rab1a
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2rhda_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rhdA (A:)
    gmnpeydylfkllligdsgvgksclllrfaddtytdsyistigvdfkirtislenktvkl
    qiwdtagqerfrtitssyyrgahgiiivydvtdrdsfdnvkqwiqeidryamenvnkllv
    gnkcdlvskrvvtsdegreladshgikfietsaknaynveqafhtmageikkrvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhdA (A:)
    npeydylfkllligdsgvgksclllrfaddtytdsyistigvdfkirtislenktvklqi
    wdtagsyyrgahgiiivydvtdrdsfdnvkqwiqeidryamenvnkllvgnkcdlvskrv
    vtsdegreladshgikfietsaknaynveqafhtmageikkrvq