PDB entry 2rh9

View 2rh9 on RCSB PDB site
Description: Tryptophan synthase complexed with IGP, internal aldimine, pH 9.0
Class: lyase
Keywords: AROMATIC AMINO ACID BIOSYNTHESIS, TRYPTOPHAN BIOSYNTHESIS, CARBON-OXYGEN LYASE, AMINOACID BIOSYNTHESIS, LYASE, ALLOSTERIC ENZYME, PYRIDOXAL PHOSPHATE, Amino-acid biosynthesis
Deposited on 2007-10-08, released 2007-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.173
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Salmonella typhimurium [TaxId:602]
    Gene: TRPA, STM1727
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rh9a_
  • Chain 'B':
    Compound: tryptophan synthase beta chain
    Species: Salmonella typhimurium [TaxId:602]
    Gene: trpB, STM1726
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rh9b_
  • Heterogens: NA, IGP, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rh9A (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
    ieknlaspkqmlaelrsfvsamkaasra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rh9A (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllslh
    hlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkqmlae
    lrsfvsamkaasra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rh9B (B:)
    mttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptalt
    kcqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasa
    lasallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgs
    yetahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigm
    fadfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysi
    sagldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalk
    mmreqpekeqllvvnlsgrgdkdiftvhdilkargei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rh9B (B:)
    ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
    cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
    asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
    etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
    adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
    agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
    mreqpekeqllvvnlsgrgdkdiftvhdilkarg