PDB entry 2rgv

View 2rgv on RCSB PDB site
Description: The crystal structure of PerR-Ox highlights 2-oxo-Histidine formation
Class: DNA binding protein
Keywords: 2-oxo-Histidine, PerR-OX, Cytoplasm, DNA-binding, Manganese, Oxidation, Repressor, Transcription, Transcription regulation, Zinc, DNA BINDING PROTEIN
Deposited on 2007-10-05, released 2008-10-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.216
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxide operon regulator
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2rgva_
  • Chain 'B':
    Compound: Peroxide operon regulator
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2rgvb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rgvA (A:)
    maahelkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvy
    nnlrvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahv
    tgfkvshhrleiygvcqecskkenh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rgvA (A:)
    helkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynnl
    rvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtgf
    kvshhrleiygvcqecskken
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rgvB (B:)
    maahelkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvy
    nnlrvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahv
    tgfkvshhrleiygvcqecskkenh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rgvB (B:)
    ahelkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynn
    lrvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtg
    fkvshhrleiygvcqecskkenh