PDB entry 2rgs

View 2rgs on RCSB PDB site
Description: FC-fragment of monoclonal antibody IGG2B from Mus musculus
Class: immune system
Keywords: Fc-fragment, immunoglobulin, glycosylation, IMMUNE SYSTEM
Deposited on 2007-10-05, released 2008-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.201
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-2B heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rgsa1, d2rgsa2
  • Chain 'B':
    Compound: Ig gamma-2B heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rgsb1, d2rgsb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rgsA (A:)
    cpapnleggpsvfifppnikdvlmisltpkvtcvvvdvseddpdvqiswfvnnvevhtaq
    tqthredynstirvvstlpiqhqdwmsgkefkckvnnkdlpspiertiskikglvrapqv
    yilpppaeqlsrkdvsltclvvgfnpgdisvewtsnghteenykdtapvldsdgsyfiys
    klnmktskwektdsfscnvrheglknyylkktisrspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rgsA (A:)
    gpsvfifppnikdvlmisltpkvtcvvvdvseddpdvqiswfvnnvevhtaqtqthredy
    nstirvvstlpiqhqdwmsgkefkckvnnkdlpspiertiskikglvrapqvyilpppae
    qlsrkdvsltclvvgfnpgdisvewtsnghteenykdtapvldsdgsyfiysklnmktsk
    wektdsfscnvrheglknyylkktis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rgsB (B:)
    cpapnleggpsvfifppnikdvlmisltpkvtcvvvdvseddpdvqiswfvnnvevhtaq
    tqthredynstirvvstlpiqhqdwmsgkefkckvnnkdlpspiertiskikglvrapqv
    yilpppaeqlsrkdvsltclvvgfnpgdisvewtsnghteenykdtapvldsdgsyfiys
    klnmktskwektdsfscnvrheglknyylkktisrspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rgsB (B:)
    gpsvfifppnikdvlmisltpkvtcvvvdvseddpdvqiswfvnnvevhtaqtqthredy
    nstirvvstlpiqhqdwmsgkefkckvnnkdlpspiertiskikglvrapqvyilpppae
    qlsrkdvsltclvvgfnpgdisvewtsnghteenykdtapvldsdgsyfiysklnmktsk
    wektdsfscnvrheglknyylkktisr