PDB entry 2rgn

View 2rgn on RCSB PDB site
Description: Crystal Structure of p63RhoGEF complex with Galpha-q and RhoA
Class: SIGNALING PROTEIN complex
Keywords: Heterotrimeric G-protein, small molecular weight G-protein, signaling complex, protein-protein complex, RhoGEF, RhoA, GalphaQ, Galpha-Q, p63RhoGEF, Gq, GTP-binding, Lipoprotein, Nucleotide-binding, Palmitate, Transducer, ADP-ribosylation, Cytoskeleton, Magnesium, Membrane, Methylation, Prenylation, Proto-oncogene, SIGNALING PROTEIN complex
Deposited on 2007-10-04, released 2008-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(q) subunit alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Gnaq
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10824
      • linker (28-29)
    • PDB 2RGN (30-End)
    Domains in SCOPe 2.07: d2rgna1, d2rgna2
  • Chain 'B':
    Compound: Rho guanine nucleotide exchange factor 25
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF25, GEFT
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOA, ARH12, ARHA, RHO12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rgnc1
  • Chain 'D':
    Compound: Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(q) subunit alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Gnaq
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10824
      • linker (28-29)
    • PDB 2RGN (30-End)
    Domains in SCOPe 2.07: d2rgnd1, d2rgnd2
  • Chain 'E':
    Compound: Rho guanine nucleotide exchange factor 25
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF25, GEFT
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOA, ARH12, ARHA, RHO12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rgnf1
  • Heterogens: ALF, MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rgnA (A:)
    mgctlsaedkaaverskmidrnlredgersrrelkllllgtgesgkstfikqmriihgsg
    ysdedkrgftklvyqniftamqamiramdtlkipykyehnkahaqlvrevdvekvsafen
    pyvdaikslwndpgiqecydrrreyqlsdstkyylndldrvadpsylptqqdvlrvrvpt
    tgiieypfdlqsvifrmvdvggqrserrkwihcfenvtsimflvalseydqvlvesdnen
    rmeeskalfrtiitypwfqnssvilflnkkdlleekimyshlvdyfpeydgpqrdaqaar
    efilkmfvdlnpdsdkiiyshftcatdtenirfvfaavkdtilqlnlkeynlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rgnA (A:)
    rsrrelkllllgtgesgkstfikqmriihgsgysdedkrgftklvyqniftamqamiram
    dtlkipykyehnkahaqlvrevdvekvsafenpyvdaikslwndpgiqecydrrreyqls
    dstkyylndldrvadpsylptqqdvlrvrvpttgiieypfdlqsvifrmvdvggqrserr
    kwihcfenvtsimflvalseydqvlvesdnenrmeeskalfrtiitypwfqnssvilfln
    kkdlleekimyshlvdyfpeydgpqrdaqaarefilkmfvdlnpdsdkiiyshftcatdt
    enirfvfaavkdtilqlnlkeynl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rgnC (C:)
    gefmaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelal
    wdtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgn
    kkdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematra
    alqarrgkkksgclvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rgnC (C:)
    irkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtagq
    edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
    dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2rgnD (D:)
    mgctlsaedkaaverskmidrnlredgersrrelkllllgtgesgkstfikqmriihgsg
    ysdedkrgftklvyqniftamqamiramdtlkipykyehnkahaqlvrevdvekvsafen
    pyvdaikslwndpgiqecydrrreyqlsdstkyylndldrvadpsylptqqdvlrvrvpt
    tgiieypfdlqsvifrmvdvggqrserrkwihcfenvtsimflvalseydqvlvesdnen
    rmeeskalfrtiitypwfqnssvilflnkkdlleekimyshlvdyfpeydgpqrdaqaar
    efilkmfvdlnpdsdkiiyshftcatdtenirfvfaavkdtilqlnlkeynlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rgnD (D:)
    rsrrelkllllgtgesgkstfikqmriihgsgysdedkrgftklvyqniftamqamiram
    dtlkipykyehnkahaqlvrevdvekvsafenpyvdaikslwndpgiqecydrrreyqls
    dstkyylndldrvadpsylptqqdvlrvrvpttgiieypfdlqsvifrmvdvggqrserr
    kwihcfenvtsimflvalseydqvlvesdnenrmeeskalfrtiitypwfqnssvilfln
    kkdlleekimyshlvdyfpeydgpqrdaqaarefilkmfvdlnpdsdkiiyshftcatdt
    enirfvfaavkdtilqlnlkeynl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2rgnF (F:)
    gefmaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelal
    wdtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgn
    kkdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematra
    alqarrgkkksgclvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rgnF (F:)
    rkklvivgdgacgktcllivfskdqfpevyvptvfenyvadelalwdtagqedydrlrpl
    sypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrndehtrrela
    kmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq