PDB entry 2rgl

View 2rgl on RCSB PDB site
Description: Rice BGlu1 beta-glucosidase, a plant exoglucanase/beta-glucosidase
Class: hydrolase
Keywords: beta-alpha-barrels, Glycosidase, Hydrolase
Deposited on 2007-10-04, released 2008-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.164
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Oryza sativa [TaxId:39947]
    Gene: Os3bglu7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rgla_
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: Oryza sativa [TaxId:39947]
    Gene: Os3bglu7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rglb_
  • Heterogens: ZN, SO4, MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rglA (A:)
    amadvvpkpnwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnva
    gnqngdvatdqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlin
    yllqkgitpyvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfn
    eprivallgydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqq
    gkvgivldfnwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkf
    tpeqarlvkgsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqan
    snwlyivpwgmygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsylt
    qlkkaideganvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlk
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rglA (A:)
    wlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvatd
    qyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitpy
    vnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfneprivallgy
    dqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldfn
    wyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvkg
    sadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqansnwlyivpwg
    mygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsyltqlkkaidega
    nvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rglB (B:)
    amadvvpkpnwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnva
    gnqngdvatdqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlin
    yllqkgitpyvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfn
    eprivallgydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqq
    gkvgivldfnwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkf
    tpeqarlvkgsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqan
    snwlyivpwgmygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsylt
    qlkkaideganvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlk
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rglB (B:)
    wlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvatd
    qyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitpy
    vnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfneprivallgy
    dqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldfn
    wyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvkg
    sadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqansnwlyivpwg
    mygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsyltqlkkaidega
    nvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh