PDB entry 2rg2

View 2rg2 on RCSB PDB site
Description: Crystal structure of variant R18L of conjugated bile acid hydrolase from Clostridium perfringens
Class: hydrolase
Keywords: Ntn-hydrolase, hydrolase, amidase, bile salt hydrolase, conjugated bile acid hydrolase, BSH, CBAH, choloylglycine hydrolase
Deposited on 2007-10-02, released 2009-02-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: choloylglycine hydrolase
    Species: Clostridium perfringens [TaxId:1502]
    Gene: cbh
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54965 (0-327)
      • engineered (16)
    Domains in SCOPe 2.02: d2rg2a_
  • Heterogens: SO4, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rg2A (A:)
    ctglaletkdglhlfglnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgtif
    ddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevke
    alknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfdw
    hvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdamik
    ndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqina
    idmnkenldgneiktykynktlsinhvn