PDB entry 2rf8

View 2rf8 on RCSB PDB site
Description: Crystal Structure of the mutant C2A conjugated bile acid hydrolase from Clostridium perfringens
Class: hydrolase
Keywords: Choloylglycine hydrolase, bile salt hydrolase, CBAH, BSH, Ntn-hydrolase, HYDROLASE
Deposited on 2007-09-28, released 2008-10-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.209
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: choloylglycine hydrolase
    Species: Clostridium perfringens
    Gene: cbh
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54965 (Start-328)
      • engineered (1)
    Domains in SCOPe 2.03: d2rf8a_
  • Chain 'B':
    Compound: choloylglycine hydrolase
    Species: Clostridium perfringens
    Gene: cbh
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54965 (0-328)
      • engineered (1)
    Domains in SCOPe 2.03: d2rf8b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rf8A (A:)
    matglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgti
    fddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevk
    ealknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfd
    whvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdami
    kndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqin
    aidmnkenldgneiktykynktlsinhvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rf8A (A:)
    atglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgtif
    ddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevke
    alknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfdw
    hvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdamik
    ndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqina
    idmnkenldgneiktykynktlsinhvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rf8B (B:)
    matglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgti
    fddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevk
    ealknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfd
    whvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdami
    kndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqin
    aidmnkenldgneiktykynktlsinhvn