PDB entry 2rez

View 2rez on RCSB PDB site
Description: Tetracenomycin ARO/CYC NaI Structure
Class: biosynthetic protein
Keywords: TETRACENOMYCIN, POLYKETIDE, AROMATASE, CYCLASE, DEHYDRATASE, HELIX-GRIP, DOUBLE-HOT-DOG, Antibiotic biosynthesis, Methyltransferase, Multifunctional enzyme, Transferase, BIOSYNTHETIC PROTEIN
Deposited on 2007-09-27, released 2008-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.206
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multifunctional cyclase-dehydratase-3-O-methyl transferase tcmN
    Species: Streptomyces glaucescens [TaxId:1907]
    Gene: tcmN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16559 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d2reza2, d2reza3
  • Heterogens: ACT, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rezA (A:)
    gshmaartdnsivvnapfelvwdvtndieawpelfseyaeaeilrqdgdgfdfrlktrpd
    angrvwewvshrvpdkgsrtvrahrvetgpfaymnlhwtyravaggtemrwvqefdmkpg
    apfdnahmtahlntttranmerikkiiedrhregqrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rezA (A:)
    gshmaartdnsivvnapfelvwdvtndieawpelfseyaeaeilrqdgdgfdfrlktrpd
    angrvwewvshrvpdkgsrtvrahrvetgpfaymnlhwtyravaggtemrwvqefdmkpg
    apfdnahmtahlntttranmerikkiiedrhregq