PDB entry 2rex

View 2rex on RCSB PDB site
Description: Crystal structure of the effector domain of PLXNB1 bound with Rnd1 GTPase
Class: signaling protein/lipoprotein
Keywords: complex, Structural Genomics Consortium, SGC, gtpase, gnp, Plexin, effector domain, Glycoprotein, Membrane, Phosphorylation, Receptor, Secreted, Transmembrane, Cytoskeleton, GTP-binding, Lipoprotein, Methylation, Nucleotide-binding, Prenylation, SIGNALING PROTEIN-LIPOPROTEIN COMPLEX
Deposited on 2007-09-27, released 2007-11-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plexin-B1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLXNB1, KIAA0407, PLXN5, SEP
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: rho-related GTP-binding protein rho6
    Species: Homo sapiens [TaxId:9606]
    Gene: RND1, RHO6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2rexb_
  • Chain 'C':
    Compound: Plexin-B1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLXNB1, KIAA0407, PLXN5, SEP
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: rho-related GTP-binding protein rho6
    Species: Homo sapiens [TaxId:9606]
    Gene: RND1, RHO6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2rexd_
  • Heterogens: MG, CA, GNP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rexB (B:)
    grapqpvvarcklvlvgdvqcgktamlqvlakdcypetyvptvfenytacleteeqrvel
    slwdtsgspyydnvrplcysdsdavllcfdisrpetvdsalkkwrteildycpstrvlli
    gcktdlrtdlstlmelshqkqapisyeqgcaiakqlgaeiylegsaftseksihsifrta
    smlclnkpsplpqkspv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rexB (B:)
    rcklvlvgdvqcgktamlqvlakdcypetyvptvfenytacleqrvelslwdtsgspyyd
    nvrplcysdsdavllcfdisrpetvalkkwrteildycpstrvlligcktdlrtdlstlm
    elshqkqapisyeqgcaiakqlgaeiylegsaftseksihsifrtasmlcl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2rexD (D:)
    grapqpvvarcklvlvgdvqcgktamlqvlakdcypetyvptvfenytacleteeqrvel
    slwdtsgspyydnvrplcysdsdavllcfdisrpetvdsalkkwrteildycpstrvlli
    gcktdlrtdlstlmelshqkqapisyeqgcaiakqlgaeiylegsaftseksihsifrta
    smlclnkpsplpqkspv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rexD (D:)
    pqpvvarcklvlvgdvqcgktamlqvlakdcypetyvptvfenytacleteeqrvelslw
    dtsgspyydnvrplcysdsdavllcfdisrpetvalkkwrteildycpstrvlligcktd
    lrtdlstlmelshqkqapisyeqgcaiakqlgaeiylegsaftseksihsifrtasmlcl