PDB entry 2rer

View 2rer on RCSB PDB site
Description: Crystal structure of the aromatase/cyclase domain of TcmN from Streptomyces glaucescens
Class: biosynthetic protein
Keywords: CYCLASE, AROMATASE, POLYKETIDE, HELIX-GRIP, DEHYDRATASE, ANTICANCER, ANTIBIOTIC, Antibiotic biosynthesis, Methyltransferase, Multifunctional enzyme, Transferase, BIOSYNTHETIC PROTEIN
Deposited on 2007-09-26, released 2008-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multifunctional cyclase-dehydratase-3-O-methyl transferase tcmN
    Species: Streptomyces glaucescens [TaxId:1907]
    Gene: tcmN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rera1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rerA (A:)
    gshmaartdnsivvnapfelvwdvtndieawpelfseyaeaeilrqdgdgfdfrlktrpd
    angrvwewvshrvpdkgsrtvrahrvetgpfaymnlhwtyravaggtemrwvqefdmkpg
    apfdnahmtahlntttranmerikkiiedrhregqrtpasvlptelhaqqlll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rerA (A:)
    maartdnsivvnapfelvwdvtndieawpelfseyaeaeilrqdgdgfdfrlktrpdang
    rvwewvshrvpdkgsrtvrahrvetgpfaymnlhwtyravaggtemrwvqefdmkpgapf
    dnahmtahlntttranmerikkiiedrhregqrtp