PDB entry 2reo

View 2reo on RCSB PDB site
Description: Crystal structure of human sulfotransferase 1C3 (Sult1C3) in complex with PAP
Class: transferase
Keywords: sulfotransferase, SULFATE CONJUGATION, PAP, STRUCTURAL GENOMICS CONSORTIUM, SGC, TRANSFERASE
Deposited on 2007-09-26, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative sulfotransferase 1C3
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2reoa_
  • Heterogens: A3P

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2reoA (A:)
    gmakieknaptmekkpelfnimevdgvptlilskewwekvanfqakpddlilatypksgt
    twmheildmilndgdvekckraqtldrhaflelkfphkekpdlefvlemsspqlikthlp
    shlippsiwkenckivyvarnpkdclvsyyhfhrmasfmpdpqnleefyekfmsgkvvgg
    swfdhvkgwwaakdmhrilylfyedikkdpkreiekilkflekdiseeilnkiiyhtsfd
    vmkqnpmtnyttlptsimdhsispfmrkgmpgdwknyftvaqneefdkdyqkkmagstlt
    frtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2reoA (A:)
    fqakpddlilatypksgttwmheildmilnqlikthlpshlippsiwkenckivyvarnp
    kdclvsyyhfhrmasfmpdpqnleefyekfmsgkvvggswfdhvkgwwaakdmhrilylf
    yedikkdpkreiekilkflekdiseeilnkiiyhtsfdvmkqnpmtnyttlptsimdhsi
    spfmrkgmpgdwknyftvaqneefdkdyqkkmastltfrtei