PDB entry 2rdv
View 2rdv on RCSB PDB site
Description: rubredoxin from desulfovibrio vulgaris miyazaki f, monoclinic crystal form
Class: electron transfer
Keywords: rubredoxin, compnd, electron transfer protein, metalloprotein, sulfate-reducing bacterium
Deposited on
1998-10-07, released
1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.48
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: rubredoxin
Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2rdva_ - Chain 'B':
Compound: rubredoxin
Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2rdvb_ - Chain 'C':
Compound: rubredoxin
Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2rdvc_ - Heterogens: FE, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2rdvA (A:)
mkkyvctvcgyeydpaegdpdngvkpgtafedvpadwvcpicgapksefepa
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2rdvB (B:)
mkkyvctvcgyeydpaegdpdngvkpgtafedvpadwvcpicgapksefepa
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2rdvC (C:)
mkkyvctvcgyeydpaegdpdngvkpgtafedvpadwvcpicgapksefepa