PDB entry 2rdl

View 2rdl on RCSB PDB site
Description: Hamster Chymase 2
Class: hydrolase/hydrolase inhibitor
Keywords: chymase 2, serine protease, hydrolase-hydrolase inhibitor complex
Deposited on 2007-09-24, released 2007-10-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.186
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chymase 2
    Species: Mesocricetus auratus [TaxId:10036]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rdla_
  • Chain 'B':
    Compound: Chymase 2
    Species: Mesocricetus auratus [TaxId:10036]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rdlb_
  • Chain 'I':
    Compound: methoxysuccinyl-ala-ala-pro-ala-chloromethylketone inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 2RDL (0-5)
  • Chain 'J':
    Compound: methoxysuccinyl-ala-ala-pro-ala-chloromethylketone inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 2RDL (0-5)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rdlA (A:)
    iiggtecrpharpymayleivtpenhlsacsgflirrnfvmtaahcagrsitvllgahnk
    kvkedtwqklevekqfphpkyddrlvlndimllklkekanltlgvgtlpisaksnsippg
    rvcravgwgrtnvneppsdtlqevkmrildpqackhfedfhqepqlcvgnpkkirnvykg
    dsggpllcagiaqgiasyvlrnakppsvftrishyrpwinkilren
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rdlB (B:)
    iiggtecrpharpymayleivtpenhlsacsgflirrnfvmtaahcagrsitvllgahnk
    kvkedtwqklevekqfphpkyddrlvlndimllklkekanltlgvgtlpisaksnsippg
    rvcravgwgrtnvneppsdtlqevkmrildpqackhfedfhqepqlcvgnpkkirnvykg
    dsggpllcagiaqgiasyvlrnakppsvftrishyrpwinkilren
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.