PDB entry 2rdb

View 2rdb on RCSB PDB site
Description: X-ray Crystal Structure of Toluene/o-Xylene Monooxygenase Hydroxylase I100W Mutant
Class: oxidoreductase
Keywords: diiron, 4-helix bundle, carboxylate bridge, metalloenzyme, tryptophan radical, Monooxygenase, OXIDOREDUCTASE
Deposited on 2007-09-21, released 2007-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toluene, o-xylene monooxygenase oxygenase subunit;alpha
    Species: Pseudomonas stutzeri [TaxId:316]
    Gene: touA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87798
      • engineered (99)
    Domains in SCOPe 2.07: d2rdba_
  • Chain 'B':
    Compound: Toluene, o-xylene monooxygenase oxygenase subunit;beta
    Species: Pseudomonas stutzeri [TaxId:316]
    Gene: touE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rdbb_
  • Chain 'C':
    Compound: Toluene, o-xylene monooxygenase oxygenase subunit;gamma
    Species: Pseudomonas stutzeri [TaxId:316]
    Gene: touB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rdbc_
  • Heterogens: GOL, P6G, FE, MPO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rdbA (A:)
    msmlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvs
    iqrekdsgaysikaalerdgfvdradpgwvstmqlhfgawaleeyaastaearmarfaka
    pgnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmm
    mtrdsvavsimltfafetgftnmqflglaadaaeagdhtfaslissiqtdesrhaqqggp
    slkilvengkkdeaqqmvdvaiwrswklfsvltgpimdyytplesrnqsfkefmlewiva
    qferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewlee
    kypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqle
    yegrlyhfgseadrwcfqidperyknhtnlvdrflkgeiqpadlagalmymslepgvmgd
    dahdyewvkayqkktnaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdbA (A:)
    smlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvsi
    qrekdsgaysikaalerdgfvdradpgwvstmqlhfgawaleeyaastaearmarfakap
    gnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmmm
    trdsvavsimltfafetgftnmqflglaadaaeagdhtfaslissiqtdesrhaqqggps
    lkilvengkkdeaqqmvdvaiwrswklfsvltgpimdyytplesrnqsfkefmlewivaq
    ferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewleek
    ypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqley
    egrlyhfgseadrwcfqidperyknhtnlvdrflkgeiqpadlagalmymslepgvmgdd
    ahdyewvkayq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rdbB (B:)
    mseqqpealkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykk
    ycfdsplkhddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvet
    larfytparylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancy
    pdvgfgkrerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgs
    laqsegdtllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkai
    eaycsalpdgenaiveaksasryvrqmmgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdbB (B:)
    alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
    khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
    arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
    rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
    tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
    pdgenaiveaksasryvrqmmg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rdbC (C:)
    matfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgt
    lfprgmivsdaglrptetldiifmdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rdbC (C:)
    tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
    prgmivsdaglrptetldiifmd