PDB entry 2rcv

View 2rcv on RCSB PDB site
Description: Crystal structure of the Bacillus subtilis superoxide dismutase
Class: oxidoreductase
Keywords: Bacillus subtilis,superoxide dismutase, Manganese, Metal-binding, Oxidoreductase, Phosphorylation, Stress response
Deposited on 2007-09-20, released 2008-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.211
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sodA, yqgD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rcva1, d2rcva2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sodA, yqgD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rcvb1, d2rcvb2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sodA, yqgD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rcvc1, d2rcvc2
  • Chain 'D':
    Compound: Superoxide dismutase [Mn]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sodA, yqgD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rcvd1, d2rcvd2
  • Chain 'E':
    Compound: Superoxide dismutase [Mn]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sodA, yqgD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rcve1, d2rcve2
  • Chain 'F':
    Compound: Superoxide dismutase [Mn]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sodA, yqgD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rcvf1, d2rcvf2
  • Chain 'G':
    Compound: Superoxide dismutase [Mn]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sodA, yqgD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rcvg1, d2rcvg2
  • Chain 'H':
    Compound: Superoxide dismutase [Mn]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sodA, yqgD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rcvh1, d2rcvh2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rcvA (A:)
    mayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvad
    ldsvpenirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfa
    aaaagrfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpd
    yisafwnvvnwdevarlyserk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rcvA (A:)
    ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvadl
    dsvpenirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfaa
    aaagrfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpdy
    isafwnvvnwdevarlyser
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rcvB (B:)
    mayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvad
    ldsvpenirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfa
    aaaagrfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpd
    yisafwnvvnwdevarlyserk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rcvB (B:)
    ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavtalanksveelvadldsv
    penirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfaaaaa
    grfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpdyisa
    fwnvvnwdevarlyser
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rcvC (C:)
    mayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvad
    ldsvpenirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfa
    aaaagrfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpd
    yisafwnvvnwdevarlyserk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rcvC (C:)
    ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvadl
    dsvpenirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfaa
    aaagrfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpdy
    isafwnvvnwdevarlyser
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2rcvD (D:)
    mayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvad
    ldsvpenirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfa
    aaaagrfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpd
    yisafwnvvnwdevarlyserk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rcvD (D:)
    ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegnanksveelvadldsv
    penirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfaaaaa
    grfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpdyisa
    fwnvvnwdevarlyser
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2rcvE (E:)
    mayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvad
    ldsvpenirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfa
    aaaagrfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpd
    yisafwnvvnwdevarlyserk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rcvE (E:)
    ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvadl
    dsvpenirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfaa
    aaagrfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpdy
    isafwnvvnwdevarlyser
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2rcvF (F:)
    mayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvad
    ldsvpenirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfa
    aaaagrfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpd
    yisafwnvvnwdevarlyserk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rcvF (F:)
    ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvadl
    dsvpenirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfaa
    aaagrfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpdy
    isafwnvvnwdevarlyser
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2rcvG (G:)
    mayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvad
    ldsvpenirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfa
    aaaagrfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpd
    yisafwnvvnwdevarlyserk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rcvG (G:)
    ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvadl
    dsvpenirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfaa
    aaagrfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpdy
    isafwnvvnwdevarlyser
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2rcvH (H:)
    mayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvad
    ldsvpenirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfa
    aaaagrfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpd
    yisafwnvvnwdevarlyserk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rcvH (H:)
    ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavtalanksveelvadldsv
    penirtavrnnggghanhklfwtllspngggeptgalaeeinsvfgsfdkfkeqfaaaaa
    grfgsgwawlvvnngkleitstpnqdsplsegktpilgldvwehayylnyqnrrpdyisa
    fwnvvnwdevarlyser