PDB entry 2rcc

View 2rcc on RCSB PDB site
Description: Crystal structure of putative class I ribonucleotide reductase (NP_241368.1) from Bacillus halodurans at 1.90 A resolution
Class: oxidoreductase
Keywords: NP_241368.1, Putative Class I Ribonucleotide Reductase, Ribonucleotide reductase, small chain, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, DNA replication, Iron, Metal-binding, Oxidoreductase
Deposited on 2007-09-19, released 2007-10-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241368.1, nrdB, BH0502
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFH7 (1-End)
      • leader sequence (0)
  • Chain 'B':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241368.1, nrdB, BH0502
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2rccb_
  • Chain 'C':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241368.1, nrdB, BH0502
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, EDO, PGE, PG4, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rccB (B:)
    gmeqlqkrkiydttasnastgilngkssnvlnwddvrfswayplyknmlanfwtpfeinm
    shdakqfptlteteqeafkkiigllafldsvqtdysmraaeyltdsslaalmsvlsfqev
    vhnqsysyvlsslvpkatqdeifeywkhddvlkernefiidgyekfvdnptpktflesiv
    ydvileglnfysgfaffynlarnqkmvststminyinrdeqlhvylftnifkellvefpe
    lnteetktfvkttlmkaadlekdwfryiigdkipginpedmetyisfiankravqlgmek
    pypeikhnpmkwirayedvnsgksdffeqksrqyakvsadngfdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rccB (B:)
    fswayplyknmlanfwtpfeinmshdakqfptlteteqeafkkiigllafldsvqtdysm
    raaeyltdsslaalmsvlsfqevvhnqsysyvlsslvpkatqdeifeywkhddvlkerne
    fiidgyekfvdnptpktflesivydvileglnfysgfaffynlarnqkmvststminyin
    rdeqlhvylftnifkellvefpelnteetktfvkttlmkaadlekdwfryiigdkipgin
    pedmetyisfiankravqlgmekpypeikhnpmkwiraye
    

  • Chain 'C':
    No sequence available.