PDB entry 2rbi

View 2rbi on RCSB PDB site
Description: structure of binase mutant his 101 asn
Deposited on 1996-11-12, released 1997-03-12
The last revision prior to the SCOP 1.63 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d2rbia_
  • Chain 'B':
    Domains in SCOP 1.63: d2rbib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rbiA (A:)
vintfdgvadylirykrlpdnyitksqasalgwvaskgnlaevapgksiggdvfsnregr
lpsasgrtwreadinyvsgfrnadrlvyssdwliykttdnyatftrir

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rbiB (B:)
vintfdgvadylirykrlpdnyitksqasalgwvaskgnlaevapgksiggdvfsnregr
lpsasgrtwreadinyvsgfrnadrlvyssdwliykttdnyatftrir