PDB entry 2rao

View 2rao on RCSB PDB site
Description: X ray crystal structure of rabbit hemoglobin (oxy form) at 2.0 angstrom resolution
Class: oxygen binding
Keywords: OXYGEN TRANPORT/STORAGE, Heme, Iron, Metal-binding, Oxygen transport, Transport, OXYGEN BINDING
Deposited on 2007-09-17, released 2008-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha-1/2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2raoa_
  • Chain 'B':
    Compound: Hemoglobin subunit beta-1/2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2raob_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha-1/2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2raoc_
  • Chain 'D':
    Compound: Hemoglobin subunit beta-1/2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2raod_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2raoA (A:)
    vlspadktniktawekigshggeygaeavermflgfpttktyfphfdfthgseqikahgk
    kvsealtkavghlddlpgalstlsdlhahklrvdpvnfkllshcllvtlanhhpseftpa
    vhasldkflanvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2raoB (B:)
    vhlsseeksavtalwgkvnveevggealgrllvvypwtqrffesfgdlssanavmnnpkv
    kahgkkvlaafseglshldnlkgtfaklselhcdklhvdpenfrllgnvlvivlshhfgk
    eftpqvqaayqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2raoC (C:)
    vlspadktniktawekigshggeygaeavermflgfpttktyfphfdfthgseqikahgk
    kvsealtkavghlddlpgalstlsdlhahklrvdpvnfkllshcllvtlanhhpseftpa
    vhasldkflanvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2raoD (D:)
    vhlsseeksavtalwgkvnveevggealgrllvvypwtqrffesfgdlssanavmnnpkv
    kahgkkvlaafseglshldnlkgtfaklselhcdklhvdpenfrllgnvlvivlshhfgk
    eftpqvqaayqkvvagvanalahkyh