PDB entry 2rah

View 2rah on RCSB PDB site
Description: Human FDPS synthase in complex with novel inhibitor
Class: transferase
Keywords: mainly alpha, orthogonal bundle, osteoporosis, Cholesterol biosynthesis, Cytoplasm, Host-virus interaction, Isoprene biosynthesis, Lipid synthesis, Steroid biosynthesis, Sterol biosynthesis, Transferase
Deposited on 2007-09-15, released 2007-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyl pyrophosphate synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: FDPS, FPS, KIAA1293
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2raha_
  • Heterogens: MG, SO4, 11P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rahA (A:)
    mgsshhhhhhssgrenlyfqghmghmngdqnsdvyaqekqdfvqhfsqivrvltedemgh
    peigdaiarlkevleynaiggkynrgltvvvafrelveprkqdadslqrawtvgwcvell
    qafflvaddimdssltrrgqicwyqkpgvgldaindanlleaciyrllklycreqpyyln
    lielflqssyqteigqtldlltapqgnvdlvrftekryksivkyktafysfylpiaaamy
    magidgekehanakkillemgeffqiqddyldlfgdpsvtgkigtdiqdnkcswlvvqcl
    qratpeqyqilkenygqkeaekvarvkalyeeldlpavflqyeedsyshimalieqyaap
    lppavflglarkiykrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rahA (A:)
    dvyaqekqdfvqhfsqivrvltedehpeigdaiarlkevleynaiggkynrgltvvvafr
    elveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgldai
    ndanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvrft
    ekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyldlf
    gdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeeld
    lpavflqyeedsyshimalieqyaaplppavflglarkiy