PDB entry 2rac

View 2rac on RCSB PDB site
Description: amicyanin reduced, ph 7.7, 1.3 angstroms
Class: electron transport
Keywords: electron transport
Deposited on 1998-10-02, released 1998-10-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.182
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (amicyanin)
  Species: Paracoccus denitrificans
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22364 (0-104)
  Domains in SCOP 1.73: d2raca_
• Heterogens: CU1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2racA (A:)
  dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
  vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve