PDB entry 2r9s

View 2r9s on RCSB PDB site
Description: c-Jun N-terminal Kinase 3 with 3,5-Disubstituted Quinoline inhibitor
Class: signaling protein, transferase
Keywords: jnk3, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2007-09-13, released 2007-10-16
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-16, with a file datestamp of 2007-10-12.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: HOMO SAPIENS
    Gene: MAPK10, JNK3, JNK3A, PRKM10
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53779 (0-355)
      • modified residue (108)
      • modified residue (129)
      • modified residue (155)
    Domains in SCOP 1.75: d2r9sa1
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 10
    Species: HOMO SAPIENS
    Gene: MAPK10, JNK3, JNK3A, PRKM10
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53779 (0-355)
      • modified residue (108)
      • modified residue (129)
      • modified residue (155)
    Domains in SCOP 1.75: d2r9sb1
  • Heterogens: 255, UNX, TFA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r9sA (A:)
    nqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqtha
    krayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldher
    msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyvv
    tryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpe
    fmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpa
    krisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykevmns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9sA (A:)
    nqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqtha
    krayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldher
    msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglaryyrapevilgmgy
    kenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrnyven
    rpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqhpyin
    vwydkqlderehtieewkeliykevmns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r9sB (B:)
    nqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqtha
    krayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldher
    msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyvv
    tryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpe
    fmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpa
    krisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykevmns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9sB (B:)
    nqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqtha
    krayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldher
    msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglaryyrapevilgmgy
    kenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrnyven
    rpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqhpyin
    vwydkqlderehtieewkeliykevmns