PDB entry 2r8k

View 2r8k on RCSB PDB site
Description: Structure of the Eukaryotic DNA Polymerase eta in complex with 1,2-d(GpG)-cisplatin containing DNA
Class: replication, transferase/DNA
Keywords: protein-cisplatin-DNA-dNTP complex, REPLICATION, TRANSFERASE-DNA COMPLEX
Deposited on 2007-09-11, released 2007-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.23
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA Polymerase ETA
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RAD30, DBH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04049 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d2r8ka1, d2r8ka2, d2r8ka3
  • Chain 'B':
    Compound: DNA Polymerase ETA
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RAD30, DBH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04049 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d2r8kb1, d2r8kb2, d2r8kb3
  • Chain 'P':
    Compound: 5'-d(*dgp*dtp*dgp*dgp*dtp*dgp*dap*dgp*dc)-3'
  • Chain 'Q':
    Compound: 5'-d(*dgp*dtp*dgp*dgp*dtp*dgp*dap*dgp*dc)-3'
  • Chain 'T':
    Compound: 5'-d(p*dgp*dgp*dcp*dtp*dcp*dap*dcp*dcp*dap*dc)-3'
  • Chain 'U':
    Compound: 5'-d(p*dgp*dgp*dcp*dtp*dcp*dap*dcp*dcp*dap*dc)-3'
  • Heterogens: CPT, CA, DTP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r8kA (A:)
    maswshpqfekgastslykkagrmskftwkeliqlgspskayesslaciahidmnaffaq
    veqmrcglskedpvvcvqwnsiiavsyaarkygisrmdtiqealkkcsnlipihtavfkk
    gedfwqyhdgcgswvqdpakqisvedhkvslepyrresrkalkifksacdlverasidev
    fldlgricfnmlmfdneyeltgdlklkdalsnireafiggnydinshlplipekikslkf
    egdvfnpegrdlitdwddvilalgsqvckgirdsikdilgyttscglsstknvcklasny
    kkpdaqtivkndclldfldcgkfeitsfwtlggvlgkelidvldlphensikhiretwpd
    nagqlkefldakvkqsdydrstsnidplktadlaeklfklsrgryglplssrpvvksmms
    nknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislktksyevyrk
    sgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdiidlqktvvd
    mfgnqvhtfkssag
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8kA (A:)
    grmskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwns
    iiavsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakq
    isvedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyelt
    gdlklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvil
    algsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcg
    kfeitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrs
    tsnidplktadlaeklfklsrgryglplssrpvvksmmsnknlrgkscnsivdciswlev
    fcaeltsriqdleqeynkiviprtvsislktksyevyrksgpvaykginfqshellkvgi
    kfvtdldikgknksyypltklsmtitnfdii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r8kB (B:)
    maswshpqfekgastslykkagrmskftwkeliqlgspskayesslaciahidmnaffaq
    veqmrcglskedpvvcvqwnsiiavsyaarkygisrmdtiqealkkcsnlipihtavfkk
    gedfwqyhdgcgswvqdpakqisvedhkvslepyrresrkalkifksacdlverasidev
    fldlgricfnmlmfdneyeltgdlklkdalsnireafiggnydinshlplipekikslkf
    egdvfnpegrdlitdwddvilalgsqvckgirdsikdilgyttscglsstknvcklasny
    kkpdaqtivkndclldfldcgkfeitsfwtlggvlgkelidvldlphensikhiretwpd
    nagqlkefldakvkqsdydrstsnidplktadlaeklfklsrgryglplssrpvvksmms
    nknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislktksyevyrk
    sgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdiidlqktvvd
    mfgnqvhtfkssag
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8kB (B:)
    grmskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwns
    iiavsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakq
    isvedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyelt
    gdlklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvil
    algsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcg
    kfeitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrs
    tsnidplktadlaeklfklsrgryglplssrpvvksmmsnknlrgkscnsivdciswlev
    fcaeltsriqdleqeynkiviprtvsislktksyevyrksgpvaykginfqshellkvgi
    kfvtdldikgknksyypltklsmtitnfdii
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.