PDB entry 2r7i

View 2r7i on RCSB PDB site
Description: Crystal structure of catalytic subunit of protein kinase CK2
Class: transferase
Keywords: catalytic subunit, kinase, ATP-binding, Nucleotide-binding, Serine/threonine-protein kinase, Transferase, Wnt signaling pathway
Deposited on 2007-09-08, released 2008-09-23
The last revision prior to the SCOP 1.75 freeze date was dated 2008-09-23, with a file datestamp of 2008-09-19.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.218
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CK2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2r7ia1
  • Chain 'B':
    Compound: Casein kinase II subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CK2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2r7ib1
  • Chain 'C':
    Compound: Casein kinase II subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CK2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2r7ic1
  • Chain 'D':
    Compound: Casein kinase II subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CK2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2r7id1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r7iA (A:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqarms
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7iA (A:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrkysevfeainitnnekvv
    vkilkpvkkkkikreikilenlrggpniitladivkdprtpalvfehvnntdfkqlyqtl
    tdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyhpgqey
    nvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlvriakv
    lgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldkllryd
    hqsrltareamehpyfytvvkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r7iB (B:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqarms
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7iB (B:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklkysevfeainitnnek
    vvvkilkpvkkkkikreikilenlrggpniitladivkrtpalvfehvnntdfkqlyqtl
    tdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyhpgqey
    nvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlvriakv
    lgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldkllryd
    hqsrltareamehpyfytvvkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2r7iC (C:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqarms
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7iC (C:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklevfeainitnnekvvv
    kilkpvkkkkikreikilenlrggpniitladivkdprtpalvfehvnntdfkqlyqtlt
    dydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyhpgqeyn
    vrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlvriakvl
    gtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldkllrydh
    qsrltareamehpyfytvvkd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2r7iD (D:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqarms
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7iD (D:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklkysevfeainitnnek
    vvvkilkpvkkkkikreikilenlrggpniitladivkdtpalvfehvnntdfkqlyqtl
    tdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyhpgqey
    nvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlvriakv
    lgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldkllryd
    hqsrltareamehpyfytvvkd