PDB entry 2r7g

View 2r7g on RCSB PDB site
Description: Structure of the retinoblastoma protein pocket domain in complex with adenovirus E1A CR1 domain
Class: transcription repressor, cell cycle
Keywords: Retinoblastoma protein, E1A, E2F displacement, TRANSCRIPTION REPRESSOR, CELL CYCLE
Deposited on 2007-09-07, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoblastoma-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r7ga1, d2r7ga2
  • Chain 'B':
    Compound: Early E1A 32 kDa protein
    Species: Human adenovirus C [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Retinoblastoma-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r7gc1, d2r7gc2
  • Chain 'D':
    Compound: Early E1A 32 kDa protein
    Species: Human adenovirus C [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Early E1A 32 kDa protein
    Species: Human adenovirus C [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r7gA (A:)
    ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgcv
    eigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
    rstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrime
    slawlsdsplfdlikqskdregkstslslfykkvyrlaylrlntlcerllsehpelehii
    wtlfqhtlqneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfk
    rvlikeeeydsiivfynsvfmqrlktnilqyastrpptlspiphipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7gA (A:)
    ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgcv
    eigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
    rstgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawls
    dsplfdlikqskdkstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlq
    neyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeey
    dsiivfynsvfmqrlktnilqyastrpptlspiphi
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2r7gC (C:)
    ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgcv
    eigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
    rstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrime
    slawlsdsplfdlikqskdregkstslslfykkvyrlaylrlntlcerllsehpelehii
    wtlfqhtlqneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfk
    rvlikeeeydsiivfynsvfmqrlktnilqyastrpptlspiphipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7gC (C:)
    ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgcv
    eigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
    rstgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawls
    dsplfdlikqskdrkstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtl
    qneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeee
    ydsiivfynsvfmqrlktnilqyastrpptlspiphi
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.