PDB entry 2r7f

View 2r7f on RCSB PDB site
Description: Crystal structure of ribonuclease II family protein from Deinococcus radiodurans, hexagonal crystal form. NorthEast Structural Genomics target DrR63
Class: hydrolase
Keywords: Ribonuclease II family protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, HYDROLASE
Deposited on 2007-09-07, released 2007-10-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease II family protein
    Species: Deinococcus radiodurans R1 [TaxId:243230]
    Gene: DR_0020
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2r7fa1, d2r7fa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r7fA (A:)
    mtqpeltpaqrtevellargradksrvlrdlklpetpeaahalllrlgvwdeartpyadr
    lraalnavelpvpdfdpaeerldlthlptfaiddegnqdpddavgvedlgggltrlwvhv
    advaalvapdspldlearargatlylpdrtigmlpdelvakaglglhevspalsicldld
    pdgnaeavdvlltrvkvqrlayqeaqarleageepfvtlarlarasrrlregegalsidl
    pevrvkadetgasvfplpkpemrtvvqecmtlagwgtaifaddneiplpfatqdyptrev
    agdtlpamwarrktlartrfqpspgphhgmgldlyaqatspmrryldlvvhqqlraflag
    rdplsskvmaahiaesqmnadatrqaerlsrrhhtlrfiaaqpervwdavvvdrrgaqat
    llipdlafdvqvntpaapgtalqvqfadidlpqmrvrarsvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7fA (A:)
    qpeltpaqrtevellargradksrvlrdlklpetpeaahalllrlgvwdeartpyadrlr
    aalnavelpvpdfdpaeerldlthlptfaiddegnqdpddavgvedlgggltrlwvhvad
    vaalvapdspldlearargatlylpdrtigmlpdelvakaglglhevspalsicldldpd
    gnaeavdvlltrvkvqrlayqeaqarleageepfvtlarlarasrrlregegalsidlpe
    vrvkadetgasvfplpkpemrtvvqecmtlagwgtaifaddneiplpfatqdyptrevag
    dtlpamwarrktlartrfqpspgphhgmgldlyaqatspmrryldlvvhqqlraflagrd
    plsskvmaahiaesqmnadatrqaerlsrrhhtlrfiaaqpervwdavvvdrrgaqatll
    ipdlafdvqvntpaapgtalqvqfadidlpqmrvrarsv