PDB entry 2r7a

View 2r7a on RCSB PDB site
Description: Crystal Structure of a Periplasmic Heme Binding Protein from Shigella dysenteriae
Class: transport protein
Keywords: periplasmic binding protein, heme transport, TRANSPORT PROTEIN
Deposited on 2007-09-07, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.21
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacterial heme binding protein
    Species: Shigella dysenteriae [TaxId:622]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r7aa_
  • Chain 'B':
    Compound: Bacterial heme binding protein
    Species: Shigella dysenteriae [TaxId:622]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r7ab_
  • Chain 'C':
    Compound: Bacterial heme binding protein
    Species: Shigella dysenteriae [TaxId:622]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r7ac_
  • Chain 'D':
    Compound: Bacterial heme binding protein
    Species: Shigella dysenteriae [TaxId:622]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r7ad_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r7aA (A:)
    aaerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrp
    dsvitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvt
    qinqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqy
    ksysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgp
    riadvveslhqqlwpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7aA (A:)
    aerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrpd
    svitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvtq
    inqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqyk
    sysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgpr
    iadvveslhqqlwpq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r7aB (B:)
    aaerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrp
    dsvitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvt
    qinqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqy
    ksysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgp
    riadvveslhqqlwpq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2r7aC (C:)
    aaerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrp
    dsvitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvt
    qinqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqy
    ksysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgp
    riadvveslhqqlwpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7aC (C:)
    aerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrpd
    svitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvtq
    inqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqyk
    sysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgpr
    iadvveslhqqlwpq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2r7aD (D:)
    aaerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrp
    dsvitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvt
    qinqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqy
    ksysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgp
    riadvveslhqqlwpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7aD (D:)
    aerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrpd
    svitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvtq
    inqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqyk
    sysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgpr
    iadvveslhqqlwpq