PDB entry 2r5p

View 2r5p on RCSB PDB site
Description: Crystal Structure Analysis of HIV-1 Subtype C Protease Complexed with Indinavir
Class: hydrolase
Keywords: HIV-1 subtype C, Aspartyl protease, Hydrolase, Protease, VIRAL PROTEIN
Deposited on 2007-09-04, released 2007-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50CM2 (0-98)
      • engineered (6)
      • engineered (32)
      • conflict (36)
      • engineered (62)
    Domains in SCOPe 2.07: d2r5pa_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50CM2 (0-98)
      • engineered (6)
      • engineered (32)
      • conflict (36)
      • engineered (62)
    Domains in SCOPe 2.07: d2r5pb_
  • Chain 'C':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50CM2 (0-98)
      • engineered (6)
      • engineered (32)
      • conflict (36)
      • engineered (62)
    Domains in SCOPe 2.07: d2r5pc_
  • Chain 'D':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50CM2 (0-98)
      • engineered (6)
      • engineered (32)
      • conflict (36)
      • engineered (62)
    Domains in SCOPe 2.07: d2r5pd_
  • Heterogens: CL, NA, MK1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r5pA (A:)
    pqitlwkrplvsikvggqikealldtgaddtvieeialpgrwkpkmiggiggfikvrqyd
    qiiieicgkkaigtvlvgptpvniigrnmltqlgctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r5pB (B:)
    pqitlwkrplvsikvggqikealldtgaddtvieeialpgrwkpkmiggiggfikvrqyd
    qiiieicgkkaigtvlvgptpvniigrnmltqlgctlnf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r5pC (C:)
    pqitlwkrplvsikvggqikealldtgaddtvieeialpgrwkpkmiggiggfikvrqyd
    qiiieicgkkaigtvlvgptpvniigrnmltqlgctlnf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r5pD (D:)
    pqitlwkrplvsikvggqikealldtgaddtvieeialpgrwkpkmiggiggfikvrqyd
    qiiieicgkkaigtvlvgptpvniigrnmltqlgctlnf