PDB entry 2r40

View 2r40 on RCSB PDB site
Description: Crystal structure of 20E bound EcR/USP
Class: gene regulation
Keywords: nuclear receptor ligand-binding domain, anti-parallel alpha-helical sandwich, ecdysone receptor, EcR, GENE REGULATION
Deposited on 2007-08-30, released 2007-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.23
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ultraspiracle
    Species: Heliothis virescens [TaxId:7102]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2r40a_
  • Chain 'D':
    Compound: Ecdysone receptor
    Species: Heliothis virescens [TaxId:7102]
    Gene: ECR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O18473
      • see remark 999 (54-55)
      • see remark 999 (216)
      • see remark 999 (222)
    Domains in SCOPe 2.06: d2r40d_
  • Heterogens: FLC, SO4, 20E, EPH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r40A (A:)
    mvqelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvvw
    ardiphfsqlemedqillikgswnelllfaiawrsmeflteerdgvdgtgnrttsppqlm
    clmpgmtlhrnsalqagvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkglk
    nrqevevlrekmflcldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlvad
    tsiagyirdalrnhappidtnmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r40A (A:)
    qelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvvwar
    diphfsqlemedqillikgswnelllfaiawrsmefltttsppqlmclmpgmtlhrnsal
    qagvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkglknrqevevlrekmfl
    cldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlvadtsiagyirdalr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2r40D (D:)
    gshmasmtggqqmgrdplknvppltanqksliarlvwyqegyeqpseedlkrvtqtwqsd
    eddedsdmpfrqitemtiltvqlivefakglpgfakisqsdqitllkacssevmmlrvar
    rydaatdsvlfannqaytrdnyrkagmayviedllhfcrcmysmmmdnvhyalltaivif
    sdrpgleqpllveeiqryylntlrvyilnqnsasprcavifgkilgilteirtlgmqnsn
    mcislklknrklppfleeiwdvadva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r40D (D:)
    vppltanqksliarlvwyqegyeqpseedlkrvtqtdmpfrqitemtiltvqlivefakg
    lpgfakisqsdqitllkacssevmmlrvarrydaatdsvlfannqaytrdnyrkagmayv
    iedllhfcrcmysmmmdnvhyalltaivifsdrpgleqpllveeiqryylntlrvyilnq
    nsasprcavifgkilgilteirtlgmqnsnmcislklknrklppfleeiwdva