PDB entry 2r3w

View 2r3w on RCSB PDB site
Description: I84V HIV-1 protease in complex with a amino decorated pyrrolidine-based inhibitor
Class: hydrolase
Keywords: protein-ligand complex, HYDROLASE
Deposited on 2007-08-30, released 2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.201
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5RZ08 (0-98)
      • engineered (83)
    Domains in SCOPe 2.08: d2r3wa_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5RZ08 (0-98)
      • engineered (83)
    Domains in SCOPe 2.08: d2r3wb_
  • Heterogens: CL, G3G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r3wA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvnvigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r3wB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvnvigrnlltqigctlnf