PDB entry 2r2i

View 2r2i on RCSB PDB site
Description: Myristoylated Guanylate Cyclase Activating Protein-1 with Calcium Bound
Class: Lyase Activator
Keywords: EF hand, GCAP, Guanylate Cyclase Activating Protein, GCAP1, GCAP-1, Calcium, Lipoprotein, Myristate, Sensory transduction, Vision, Lyase Activator
Deposited on 2007-08-25, released 2007-12-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylyl cyclase-activating protein 1
    Species: Gallus gallus [TaxId:9031]
    Gene: GUCA1A, GCAP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P79880 (0-End)
      • engineered (4)
    Domains in SCOPe 2.06: d2r2ia_
  • Heterogens: CA, MYR, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r2iA (A:)
    gnmdskaveelsatechqwykkfmtecpsgqltlyefkqffglknlspsankyveqmfet
    fdfnkdgyidfmeyvaalslvlkgkvdqklrwyfklydvdgngcidrgellniikairai
    nrcneamtaeeftnmvfdkidingdgelsleefmegvqkdevlldiltrsldlthivkli
    qndgknphapeeaeeaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r2iA (A:)
    gnmdskaveelsatechqwykkfmtecpsgqltlyefkqffglknlspsankyveqmfet
    fdfnkdgyidfmeyvaalslvlkgkvdqklrwyfklydvdgngcidrgellniikairai
    nrcneamtaeeftnmvfdkidingdgelsleefmegvqkdevlldiltrsldlthivkli
    qndg